PDB entry 3b2q

View 3b2q on RCSB PDB site
Description: Intermediate position of ATP on its trail to the binding pocket inside the subunit B mutant R416W of the energy converter A1Ao ATP synthase
Class: hydrolase
Keywords: HYDROLASE, ATP synthesis, Hydrogen ion transport, Ion transport, Transport
Deposited on 2007-10-19, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase beta chain
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: atpB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60187
      • engineered (424)
    Domains in SCOPe 2.07: d3b2qa1, d3b2qa2, d3b2qa3
  • Chain 'B':
    Compound: V-type ATP synthase beta chain
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: atpB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60187 (Start-468)
      • engineered (424)
    Domains in SCOPe 2.07: d3b2qb1, d3b2qb2, d3b2qb3
  • Heterogens: ATP, AES, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b2qA (A:)
    mkhhhhhhpmvkeyktitqiagplifvektepvgyneivnikmgdgtvrrgqvldssadi
    vvvqvfegtggldkdcgviftgetlklpasvdllgrilsgsgeprdggprivpdqlldin
    gaamnpyarlppkdfiqtgistidgtntlvrgqklpifsasglphneialqiarqasvpg
    sesafavvfaamgitneeaqyfmsdfektgaleravvflnladdpaverivtprmaltaa
    eylayehgmhvlviltditnyaealrqmgaarnevpgrrgypgymytdlatlyeragivk
    gakgsvtqipilsmpgddithpipdlsgyitegqivvarelhrkgiyppinvlpslsrlm
    nsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedkf
    vrqgwnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2qA (A:)
    iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfeiftgetlklpas
    vdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistidgtntlv
    rgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfmsdfektg
    aleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaealrqmga
    arnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsgyi
    tegqivvarelhrkgiyppinvlpslsrlmnsgigagktredhkavsdqmyagyaegrdl
    rglvaivgkealserdtkflefadlfedkfvrqgwnenrtiedtleigwqilthlpenql
    gridnkyiqkyhpahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b2qB (B:)
    mkhhhhhhpmvkeyktitqiagplifvektepvgyneivnikmgdgtvrrgqvldssadi
    vvvqvfegtggldkdcgviftgetlklpasvdllgrilsgsgeprdggprivpdqlldin
    gaamnpyarlppkdfiqtgistidgtntlvrgqklpifsasglphneialqiarqasvpg
    sesafavvfaamgitneeaqyfmsdfektgaleravvflnladdpaverivtprmaltaa
    eylayehgmhvlviltditnyaealrqmgaarnevpgrrgypgymytdlatlyeragivk
    gakgsvtqipilsmpgddithpipdlsgyitegqivvarelhrkgiyppinvlpslsrlm
    nsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedkf
    vrqgwnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2qB (B:)
    agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegviftgetlklpa
    svdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistidgtntl
    vrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfmsdfekt
    galeravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaealrqmg
    rgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsgyitegqivva
    relhrkgiyppinvlpslsrlmnsgigagktredhkavsdqmyagyaegrdlrglvaivg
    kealserdtkflefadlfedkfvrqgwnenrtiedtleigwqilthlpenqlgridnkyi
    qkyhpahrkak