PDB entry 3b2n

View 3b2n on RCSB PDB site
Description: Crystal structure of DNA-binding response regulator, LuxR family, from Staphylococcus aureus
Class: transcription
Keywords: STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, Q99UF4, DNA-binding, Transcription, Transcription regulation
Deposited on 2007-10-18, released 2007-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein Q99UF4
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: SAV1322
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99UF4 (3-End)
    • expression tag (2)
  Domains in SCOPe 2.08: d3b2na1, d3b2na2
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3b2nA (A:)
  msltsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiemp
  gmtglevlaeirkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkv
  nngekeghhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3b2nA (A:)
  ltsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiempgm
  tglevlaeirkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkvnn