PDB entry 3b2n

View 3b2n on RCSB PDB site
Description: Crystal structure of DNA-binding response regulator, LuxR family, from Staphylococcus aureus
Class: transcription
Keywords: STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, Q99UF4, DNA-binding, Transcription, Transcription regulation
Deposited on 2007-10-18, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Q99UF4
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV1322
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99UF4 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3b2na1, d3b2na2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b2nA (A:)
    msltsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiemp
    gmtglevlaeirkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkv
    nngekeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2nA (A:)
    ltsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiempgm
    tglevlaeirkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkvnn