PDB entry 3b1l

View 3b1l on RCSB PDB site
Description: Crystal Structure of parkin ubiquitin-like domain R33Q mutant
Class: ligase
Keywords: Parkin, Ubiquitin, proteasome, Alfa-Beta-protein, LIGASE
Deposited on 2011-07-04, released 2012-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: E3 ubiquitin-protein ligase parkin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WVS6 (0-75)
    • engineered mutation (32)
  Domains in SCOPe 2.04: d3b1lx_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b1lX (X:)
  mivfvrfnssygfpvevdsdtsilqlkevvakqqgvpadqlrvifagkelpnhltvqncd
  leqqsivhivqrprrr