PDB entry 3b13

View 3b13 on RCSB PDB site
Description: Crystal structure of the DHR-2 domain of DOCK2 in complex with Rac1 (T17N mutant)
Class: protein binding/signaling protein
Keywords: protein-ptotein complex, lymphocyte chemotaxis, signal tansduction, guanine nucleotide exchange factor, GTPase, PROTEIN BINDING-SIGNALING PROTEIN complex
Deposited on 2011-06-24, released 2012-03-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.185
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dedicator of cytokinesis protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DOCK2, KIAA0209
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (7-183)
      • engineered mutation (23)
    Domains in SCOPe 2.04: d3b13b_
  • Chain 'C':
    Compound: dedicator of cytokinesis protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DOCK2, KIAA0209
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (7-183)
      • engineered mutation (23)
    Domains in SCOPe 2.04: d3b13d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b13B (B:)
    gssgssgmqaikcvvvgdgavgkncllisyttnafpgeyiptvfdnysanvmvdgkpvnl
    glwdtagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilv
    gtkldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeai
    ravl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b13B (B:)
    mqaikcvvvgdgavgkncllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b13D (D:)
    gssgssgmqaikcvvvgdgavgkncllisyttnafpgeyiptvfdnysanvmvdgkpvnl
    glwdtagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilv
    gtkldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeai
    ravl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b13D (D:)
    mqaikcvvvgdgavgkncllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl