PDB entry 3b0a

View 3b0a on RCSB PDB site
Description: Crystal structure of the mouse HOIL1-L-NZF in complex with linear di-ubiquitin
Class: signaling protein/metal binding protein
Keywords: protein complex, SIGNALING PROTEIN-METAL BINDING PROTEIN complex
Deposited on 2011-06-07, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b0aa1, d3b0aa2
  • Chain 'B':
    Compound: RanBP-type and C3HC4-type zinc finger-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Rbck1, Rbck, Ubce7ip3, Uip28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUB0 (5-End)
      • expression tag (4)
  • Chain 'D':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b0ad1, d3b0ad2
  • Chain 'E':
    Compound: RanBP-type and C3HC4-type zinc finger-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Rbck1, Rbck, Ubce7ip3, Uip28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUB0 (5-End)
      • expression tag (0-4)
  • Heterogens: TAM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b0aA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b0aA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b0aD (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

  • Chain 'E':
    No sequence available.