PDB entry 3b08

View 3b08 on RCSB PDB site
Description: Crystal structure of the mouse HOIL1-L-NZF in complex with linear di-ubiquitin
Class: signaling protein/metal binding protein
Keywords: protein complex, SIGNALING PROTEIN-METAL BINDING PROTEIN complex
Deposited on 2011-06-07, released 2011-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b08a1, d3b08a2
  • Chain 'B':
    Compound: RanBP-type and C3HC4-type zinc finger-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Rbck1, Rbck, Ubce7ip3, Uip28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUB0 (5-End)
      • expression tag (4)
  • Chain 'D':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b08d1, d3b08d2
  • Chain 'E':
    Compound: RanBP-type and C3HC4-type zinc finger-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Rbck1, Rbck, Ubce7ip3, Uip28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUB0 (5-End)
      • expression tag (4)
  • Chain 'G':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b08g1, d3b08g2
  • Chain 'H':
    Compound: RanBP-type and C3HC4-type zinc finger-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Rbck1, Rbck, Ubce7ip3, Uip28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUB0 (5-End)
      • expression tag (4)
  • Chain 'J':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b08j1, d3b08j2
  • Chain 'K':
    Compound: RanBP-type and C3HC4-type zinc finger-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Rbck1, Rbck, Ubce7ip3, Uip28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUB0 (5-End)
      • expression tag (3-4)
  • Heterogens: ZN, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b08A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b08A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b08D (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b08D (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrg
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3b08G (G:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b08G (G:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlr
    

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3b08J (J:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b08J (J:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'K':
    No sequence available.