PDB entry 3azw

View 3azw on RCSB PDB site
Description: Crystal structure of the receptor binding domain
Class: toxin
Keywords: beta-trefoil fold, beta-sheet jellyroll fold, TOXIN
Deposited on 2011-06-02, released 2011-12-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.257
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D/C mosaic neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3azwa1, d3azwa2
  • Chain 'B':
    Compound: D/C mosaic neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3azwb1, d3azwb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3azwA (A:)
    mineyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrg
    kvivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvf
    tlkqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltg
    infsktitfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnvvk
    dywgndlrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntnd
    trvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcn
    tfdyyasqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyasllests
    thwvfvpaselehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azwA (A:)
    neyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkv
    ivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftl
    kqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltgin
    fsktitfqmnkipnninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydk
    eyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyf
    nttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlfl
    ssnattnrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3azwB (B:)
    mineyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrg
    kvivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvf
    tlkqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltg
    infsktitfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnvvk
    dywgndlrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntnd
    trvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcn
    tfdyyasqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyasllests
    thwvfvpaselehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azwB (B:)
    neyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkv
    ivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftl
    kqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltgin
    fsktitfqmnkipnninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydk
    eyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyf
    nttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlfl
    ssnattnrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas