PDB entry 3azv

View 3azv on RCSB PDB site
Description: Crystal structure of the receptor binding domain
Class: toxin
Keywords: beta-trefoil fold, beta-sheet jellyroll, receptor binding, ganglioside, extra-cellular, TOXIN
Deposited on 2011-06-02, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D/C mosaic neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azva1, d3azva2
  • Chain 'B':
    Compound: D/C mosaic neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azvb1, d3azvb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3azvA (A:)
    meyfnnineyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgss
    gddrgkvivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiis
    nflvftlkqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikv
    keltginfsktitfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqy
    tnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrir
    gntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfi
    iqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyasl
    leststhwvfvpaselehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azvA (A:)
    neyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkv
    ivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftl
    kqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltgin
    fsktitfqmnkipnninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydk
    eyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyf
    nttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlfl
    ssnattnrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3azvB (B:)
    meyfnnineyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgss
    gddrgkvivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiis
    nflvftlkqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikv
    keltginfsktitfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqy
    tnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrir
    gntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfi
    iqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyasl
    leststhwvfvpaselehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azvB (B:)
    neyfnsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkv
    ivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftl
    kqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltgin
    fsktitfqmnkipnninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydk
    eyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyf
    nttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlfl
    ssnattnrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas