PDB entry 3azr

View 3azr on RCSB PDB site
Description: Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose
Class: hydrolase
Keywords: cellulose, cellulase, biofuel, Tim Barrel, HYDROLASE
Deposited on 2011-05-30, released 2011-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.201
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_1751
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X273 (0-End)
      • engineered mutation (252)
    Domains in SCOPe 2.06: d3azra_
  • Chain 'B':
    Compound: endoglucanase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_1751
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X273
      • engineered mutation (252)
    Domains in SCOPe 2.06: d3azrb_
  • Heterogens: BGC, CBK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3azrA (A:)
    mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwstha
    yafppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiad
    rykdypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisale
    klsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfiee
    wskknkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrk
    twnkdllealiggdsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azrA (A:)
    mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwstha
    yafppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiad
    rykdypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisale
    klsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfiee
    wskknkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrk
    twnkdlleali
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3azrB (B:)
    mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwstha
    yafppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiad
    rykdypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisale
    klsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfiee
    wskknkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrk
    twnkdllealiggdsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azrB (B:)
    dpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayaf
    ppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadryk
    dypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisalekls
    vpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieewsk
    knkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrktwn
    kdlleali