PDB entry 3ays

View 3ays on RCSB PDB site
Description: GH5 endoglucanase from a ruminal fungus in complex with cellotriose
Class: hydrolase
Keywords: Tim barrel, hydrolase, Carbohydrate/Sugar Binding
Deposited on 2011-05-16, released 2011-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Piromyces rhizinflatus [TaxId:73428]
    Gene: egla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9URH5 (14-End)
      • engineered mutation (167)
    Domains in SCOPe 2.06: d3aysa_
  • Heterogens: CT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aysA (A:)
    mahhhhhhvddddkirdisskelikemnfgwnlgntmdaqcieylnyekdqtasetcwgn
    pkttedmfkvlidnqfnvfripttwsghfgeapdykidekwlkrvhevvdypykngafvi
    lnlhhetwnhafsetldtakeilekiwsqiaeefkdydehlifeglnaprkndtpvewtg
    gdqegwdavnamnavflktvrsaggnnpkrhlmippyaaacnensfnnfifpedddkvia
    svhayapynfalnngegavdkfdaagkrdlewninlmkkrfvdqgipmilgeygamnrdn
    eedratwaefymekvtamgvpqiwwdngvfegtgerfglldrknlkivyptivaalqkgr
    glevnvvhaieketee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aysA (A:)
    irdisskelikemnfgwnlgntmdaqcieylnyekdqtasetcwgnpkttedmfkvlidn
    qfnvfripttwsghfgeapdykidekwlkrvhevvdypykngafvilnlhhetwnhafse
    tldtakeilekiwsqiaeefkdydehlifeglnaprkndtpvewtggdqegwdavnamna
    vflktvrsaggnnpkrhlmippyaaacnensfnnfifpedddkviasvhayapynfalnn
    gegavdkfdaagkrdlewninlmkkrfvdqgipmilgeygamnrdneedratwaefymek
    vtamgvpqiwwdngvfegtgerfglldrknlkivyptivaalqkgrglevnvvhaie