PDB entry 3axm

View 3axm on RCSB PDB site
Description: Structure of rice Rubisco in complex with 6PG
Class: Lyase
Keywords: alpha/beta barrel, photosynthetic carbon reduction, Lyase
Deposited on 2011-04-11, released 2012-04-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.171
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axma1, d3axma2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axmb1, d3axmb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axmc1, d3axmc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axmd1, d3axmd2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axme1, d3axme2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axmf1, d3axmf2
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axmg1, d3axmg2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3axmh1, d3axmh2
  • Chain 'S':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axms_
  • Chain 'T':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmt_
  • Chain 'U':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmu_
  • Chain 'V':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmv_
  • Chain 'W':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmw_
  • Chain 'X':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmx_
  • Chain 'Y':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmy_
  • Chain 'Z':
    Compound: Ribulose bisphosphate carboxylase small chain, chloroplastic
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0INY7 (1-End)
      • amidation (0)
    Domains in SCOPe 2.03: d3axmz_
  • Heterogens: MG, 6PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3axmA (A:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmA (A:)
    gfkagvtyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdglts
    ldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrle
    dlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrgg
    ldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravf
    arelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvlak
    alrmsggdhihagtvvgkeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvas
    ggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlar
    egneiirsackwspelaaaceiwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3axmB (B:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmB (B:)
    gfkagvkltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgl
    tsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralr
    ledlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclr
    ggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikra
    vfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvl
    akalrmsggdhihagtveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasg
    gihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlare
    gneiirsackwspelaaaceiwk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3axmC (C:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmC (C:)
    gfkagvltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdglt
    sldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrl
    edlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrg
    gldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikrav
    farelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvla
    kalrmsggdhihagtvveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasg
    gihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlare
    gneiirsackwspelaaaceiwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3axmD (D:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmD (D:)
    gfkagvkltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgl
    tsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralr
    ledlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclr
    ggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikra
    vfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvl
    akalrmsggdhihagtvveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvas
    ggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlar
    egneiirsackwspelaaaceiwk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3axmE (E:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmE (E:)
    gfkagvltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdglt
    sldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrl
    edlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrg
    gldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikrav
    farelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvla
    kalrmsggdhihagteremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggi
    hvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregn
    eiirsackwspelaaaceiwk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3axmF (F:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmF (F:)
    gfkagvkltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgl
    tsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralr
    ledlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclr
    ggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikra
    vfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvl
    akalrmsggdhihagtvveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvas
    ggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlar
    egneiirsackwspelaaaceiwk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3axmG (G:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmG (G:)
    gfkagvltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdglt
    sldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrl
    edlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclrg
    gldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikrav
    farelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvla
    kalrmsggdhihagteremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggi
    hvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregn
    eiirsackwspelaaaceiwk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3axmH (H:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmH (H:)
    gfkagvkltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgl
    tsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralr
    ledlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracyeclr
    ggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikra
    vfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhfrvl
    akalrmsggdhihagtvveremtlgfvdllrddfiekdrargifftqdwvsmpgvipvas
    ggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlar
    egneiirsackwspelaaaceiwk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3axmS (S:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmS (S:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3axmT (T:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmT (T:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3axmU (U:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmU (U:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3axmV (V:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmV (V:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3axmW (W:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmW (W:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3axmX (X:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmX (X:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3axmY (Y:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmY (Y:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3axmZ (Z:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axmZ (Z:)
    xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
    yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
    pgc