PDB entry 3axl

View 3axl on RCSB PDB site
Description: Murine Valpha 10 Vbeta 8.1 T-cell receptor
Class: immune system
Keywords: Immunoglobulin fold, T-cell receptor, CD1d binding, IMMUNE SYSTEM
Deposited on 2011-04-11, released 2011-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.258
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Valpha 10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXL (0-197)
    Domains in SCOPe 2.06: d3axla1, d3axla2
  • Chain 'B':
    Compound: Vbeta 8.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXL (0-237)
    Domains in SCOPe 2.06: d3axlb1, d3axlb2
  • Chain 'G':
    Compound: Valpha 10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXL (0-197)
    Domains in SCOPe 2.06: d3axlg1, d3axlg2
  • Chain 'H':
    Compound: Vbeta 8.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AXL (0-237)
    Domains in SCOPe 2.06: d3axlh1, d3axlh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3axlA (A:)
    qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspswaeqrggrlts
    saasnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpniqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfa
    canafnnsiipedtffps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axlA (A:)
    qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyeqrggrltssaasr
    sslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpniqnpdpavyqlrdvclftd
    fdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacanafnnsiipedtf
    fps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3axlB (B:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcasrlggyeqyfgpgtrltvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3axlG (G:)
    qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspswaeqrggrlts
    saasnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpniqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfa
    canafnnsiipedtffps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axlG (G:)
    qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspseqrggrltssa
    asnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpniqnpdpavyqlrd
    svclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacanafnns
    iipedtffps
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3axlH (H:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcasrlggyeqyfgpgtrltvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra