PDB entry 3axc

View 3axc on RCSB PDB site
Description: Crystal structure of linear diubiquitin
Class: signaling protein
Keywords: NF kappa B signaling, SIGNALING PROTEIN
Deposited on 2011-04-01, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: Rps27a, Uba80, Ubcep1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3axca1, d3axca2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3axcA (A:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqr
    lifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3axcA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl