PDB entry 3avq

View 3avq on RCSB PDB site
Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with N9-Pan
Class: transferase/transferase inhibitor
Keywords: HOMODIMER, COA BIOSYNTHESIS, NUCLEOTIDE BINDING, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-03-06, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.204
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pantothenate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaA, Rv1092c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3avqa_
  • Heterogens: MV1, FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3avqA (A:)
    mgsshhhhhhmsrlsepspyvefdrrqwralrmstplalteeelvglrglgeqidlleve
    evylplarlihlqvaarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvl
    qallarwdhhprvdlvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsd
    yacapvyshlhydiipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdaried
    ieqwyvsrflamrttafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrp
    ratlvlrkdadhsinrlrlrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3avqA (A:)
    epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
    arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
    vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
    pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
    afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
    rlrlrkl