PDB entry 3aue
View 3aue on RCSB PDB site
Description: A simplified BPTI variant with poly His amino acid tag (C5H) at the C-terminus
Class: hydrolase inhibitor
Keywords: Serine protease inhibitor, Inhibits serine protease, Trypsin, HYDROLASE INHIBITOR
Deposited on
2011-02-03, released
2012-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-02-08, with a file datestamp of
2012-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.169
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3auea_ - Chain 'B':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3aueb1, d3aueb2 - Chain 'C':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3auef_ - Chain 'G':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3aueg_ - Chain 'H':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3aueA (A:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh
Sequence, based on observed residues (ATOM records): (download)
>3aueA (A:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaa
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3aueB (B:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh
Sequence, based on observed residues (ATOM records): (download)
>3aueB (B:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>3aueF (F:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh
Sequence, based on observed residues (ATOM records): (download)
>3aueF (F:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaa
- Chain 'G':
Sequence, based on SEQRES records: (download)
>3aueG (G:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh
Sequence, based on observed residues (ATOM records): (download)
>3aueG (G:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaaca
- Chain 'H':
No sequence available.