PDB entry 3aue

View 3aue on RCSB PDB site
Description: A simplified BPTI variant with poly His amino acid tag (C5H) at the C-terminus
Class: hydrolase inhibitor
Keywords: Serine protease inhibitor, Inhibits serine protease, Trypsin, HYDROLASE INHIBITOR
Deposited on 2011-02-03, released 2012-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.169
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
    Domains in SCOPe 2.08: d3auea_
  • Chain 'B':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
    Domains in SCOPe 2.08: d3aueb1, d3aueb2
  • Chain 'C':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
  • Chain 'D':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
  • Chain 'E':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
  • Chain 'F':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
    Domains in SCOPe 2.08: d3auef_
  • Chain 'G':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
    Domains in SCOPe 2.08: d3aueg_
  • Chain 'H':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 3AUE (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3aueA (A:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3aueA (A:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaa

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3aueB (B:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3aueB (B:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >3aueF (F:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3aueF (F:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaa

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >3aueG (G:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaagg
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3aueG (G:)
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaaca

  • Chain 'H':
    No sequence available.