PDB entry 3at6

View 3at6 on RCSB PDB site
Description: Side-necked turtle (Pleurodira, Chelonia, REPTILIA) hemoglobin: cDNA-derived primary structures and X-ray crystal structures of Hb A
Class: oxygen transport
Keywords: HEMOGLOBIN A, Podocnemis unifilis, Pleurodira, Chelonia, REPTILIA, OXYGEN STORAGE-TRANSPORT COMPLEX, OXYGEN TRANSPORT
Deposited on 2010-12-26, released 2011-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.24
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AlphaA-globin
    Species: Podocnemis unifilis [TaxId:227871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3at6a_
  • Chain 'B':
    Compound: Beta-globin
    Species: Podocnemis unifilis [TaxId:227871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3at6b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3at6A (A:)
    vlspgdkanvktvwskvsghvedygaetlerlfrvypstktyfphfdlhhdsaqirthgk
    kvltaigeavshiddiasalsklsdlhaqtlrvdpvnfkllshsflvvlavhapslltpe
    vhvsldkflvavsnvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3at6B (B:)
    sdftqeerqfivnlwgrvdveqigaealarllivypwtqrffssfgnlsspsailhnakv
    hahgkkvltsfgeavknldqikqtfaqlselhsdklhvdpenfkllgniliivlaahfgk
    dftpasqaawqklvsavahalalryh