PDB entry 3ark

View 3ark on RCSB PDB site
Description: Cl- binding hemoglobin component V form Propsilocerus akamusi under 1 M NaCl at pH 4.6
Class: oxygen transport
Keywords: Propsilocerus akamusi, insect hemoglobin, chloride ion binding, OXYGEN TRANSPORT
Deposited on 2010-12-02, released 2011-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.19
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin v
    Species: Tokunagayusurika akamusi [TaxId:28383]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3arka_
  • Heterogens: HEM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3arkA (A:)
    afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
    anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
    ldsthgaawnkmmdnffyvfyecldgrcsqfs