PDB entry 3ap9

View 3ap9 on RCSB PDB site
Description: Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with Lacto-N-fucopentaose III
Class: Sugar Binding Protein
Keywords: Beta-Sandwich, Galectin, Carbohydrate/Sugar Binding, Lacto-N-fucopentaose III, Sugar Binding Protein
Deposited on 2010-10-12, released 2011-02-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.158
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (Start-153)
      • see remark 999 (55)
    Domains in SCOPe 2.01: d3ap9a_
  • Heterogens: MPD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ap9A (A:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ap9A (A:)
    slnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradva
    fhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkht
    llyghrigpekidtlgiygkvnihsigfsfs