PDB entry 3an4

View 3an4 on RCSB PDB site
Description: Human PPAR gamma ligand binding domain in complex with a gamma selective agonist MO4R
Class: transcription
Keywords: mainly alpha, nuclear receptor, TRANSCRIPTION
Deposited on 2010-08-30, released 2011-07-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3an4b_
  • Heterogens: M7R, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3an4B (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3an4B (B:)
    pesadlralakhlydsyiksfpltkakarailtgktspfviydmnslmmgedkikfkhke
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetdmslhpllqeiy