PDB entry 3amg

View 3amg on RCSB PDB site
Description: Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form
Class: hydrolase
Keywords: glycosyl hydrolase family 5, cellulase, biofuel, hyperthermostable, HYDROLASE
Deposited on 2010-08-20, released 2011-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_1751
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X273
      • engineered mutation (135)
    Domains in SCOPe 2.06: d3amga_
  • Chain 'B':
    Compound: endoglucanase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_1751
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X273
      • engineered mutation (135)
    Domains in SCOPe 2.06: d3amgb_
  • Heterogens: BGC, CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3amgA (A:)
    mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwstha
    yafppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiad
    rykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisale
    klsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfiee
    wskknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrk
    twnkdllealiggdsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3amgA (A:)
    gvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthay
    afppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadr
    ykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalek
    lsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieew
    skknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrkt
    wnkdllealig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3amgB (B:)
    mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwstha
    yafppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiad
    rykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisale
    klsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfiee
    wskknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrk
    twnkdllealiggdsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3amgB (B:)
    gvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthay
    afppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadr
    ykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalek
    lsvpkweknsivtihyynpfefthqgaewvegsekfieewskknkrpiyigefgayrkad
    lesrikwtsfvvremekrrwswaywefcsgfgvydtlrktwnkdllealig