PDB entry 3alt

View 3alt on RCSB PDB site
Description: Crystal structure of CEL-IV complexed with Melibiose
Class: sugar binding protein
Keywords: CEL-IV, C-type lectin, Melibiose, SUGAR BINDING PROTEIN
Deposited on 2010-08-07, released 2011-01-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3alta_
  • Chain 'B':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3altb_
  • Chain 'C':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3altc_
  • Chain 'D':
    Compound: Lectin CEL-IV, C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3altd_
  • Heterogens: CA, MLB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3altA (A:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3altA (A:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3altB (B:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3altB (B:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3altC (C:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3altC (C:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3altD (D:)
    cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
    afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
    rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3altD (D:)
    ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
    fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
    gaiaagdysrgfwadvysnnnfkyicqlpcvhytle