PDB entry 3alt

View 3alt on RCSB PDB site
Description: Crystal structure of CEL-IV complexed with Melibiose
Class: sugar binding protein
Keywords: CEL-IV, C-type lectin, Melibiose, SUGAR BINDING PROTEIN
Deposited on 2010-08-07, released 2011-01-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lectin CEL-IV, C-type
  Species: Cucumaria echinata [TaxId:40245]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M4F9 (Start-156)
• Chain 'B':
  Compound: Lectin CEL-IV, C-type
  Species: Cucumaria echinata [TaxId:40245]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M4F9 (Start-156)
• Chain 'C':
  Compound: Lectin CEL-IV, C-type
  Species: Cucumaria echinata [TaxId:40245]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M4F9 (Start-156)
• Chain 'D':
  Compound: Lectin CEL-IV, C-type
  Species: Cucumaria echinata [TaxId:40245]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M4F9 (Start-156)
  Domains in SCOPe 2.02: d3altd_
• Heterogens: CA, MLB, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3altD (D:)
  cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
  afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
  rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3altD (D:)
  ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
  fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
  gaiaagdysrgfwadvysnnnfkyicqlpcvhytle