PDB entry 3ak9

View 3ak9 on RCSB PDB site
Description: Crystal structure of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis, FE-soaked form
Class: METAL BINDING PROTEIN, Oxidoreductase
Keywords: Dps-like protein, dodecamer, Iron-binding protein, METAL BINDING PROTEIN, Oxidoreductase
Deposited on 2010-07-08, released 2011-01-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.154
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9a_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9b_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9c_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9d_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9e_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9f_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9g_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9h_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9i_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9j_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9k_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ak9l_
  • Heterogens: FE2, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ak9A (A:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9A (A:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ak9B (B:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9B (B:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ak9C (C:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9C (C:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ak9D (D:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9D (D:)
    llytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    tdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandvr
    kaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ak9E (E:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9E (E:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ak9F (F:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9F (F:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ak9G (G:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9G (G:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ak9H (H:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9H (H:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ak9I (I:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9I (I:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ak9J (J:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9J (J:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ak9K (K:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9K (K:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ak9L (L:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak9L (L:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie