SCOPe 2.08: Structural Classification of Proteins

PDB entry 3ak9

View 3ak9 on RCSB PDB site
Description: Crystal structure of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis, FE-soaked form
Class: METAL BINDING PROTEIN, Oxidoreductase
Keywords: Dps-like protein, dodecamer, Iron-binding protein, METAL BINDING PROTEIN, Oxidoreductase
Deposited on 2010-07-08, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.154
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9a_
Chain 'B':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9b_
Chain 'C':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9c_
Chain 'D':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9d_
Chain 'E':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9e_
Chain 'F':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9f_
Chain 'G':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9g_
Chain 'H':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9h_
Chain 'I':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9i_
Chain 'J':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9j_
Chain 'K':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9k_
Chain 'L':
Compound: DNA protection during starvation protein
Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
Database cross-references and differences (RAF-indexed):
- Uniprot B3YEF4 (Start-166)
Domains in SCOPe 2.08: d3ak9l_
Heterogens: FE2, SO4, MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3ak9A (A:)
mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie