PDB entry 3ak8

View 3ak8 on RCSB PDB site
Description: Crystal structure of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis
Class: METAL BINDING PROTEIN, Oxidoreductase
Keywords: Dps-like protein, dodecamer, Iron-binding protein, METAL BINDING PROTEIN, Oxidoreductase
Deposited on 2010-07-08, released 2011-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.178
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ak8i_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ak8I (I:)
    mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak8I (I:)
    nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
    rkaigeakdedtadiftaasrdldkflwfiesnie
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.