PDB entry 3ak8

View 3ak8 on RCSB PDB site
Description: Crystal structure of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis
Class: METAL BINDING PROTEIN, Oxidoreductase
Keywords: Dps-like protein, dodecamer, Iron-binding protein, METAL BINDING PROTEIN, Oxidoreductase
Deposited on 2010-07-08, released 2011-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.178
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'B':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'C':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'D':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'E':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'F':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'G':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'H':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'I':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
  Domains in SCOPe 2.02: d3ak8i_
• Chain 'J':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'K':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Chain 'L':
  Compound: DNA protection during starvation protein
  Species: Salmonella enterica subsp. enterica serovar Kentucky [TaxId:439842]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3YEF4 (Start-166)
• Heterogens: SO4, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  Sequence, based on SEQRES records: (download)
  

  >3ak8I (I:)
  mstaklvktkasnllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfi
  avhemldgfrtaltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
  ladryavvandvrkaigeakdedtadiftaasrdldkflwfiesnie
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ak8I (I:)
  nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
  ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
  rkaigeakdedtadiftaasrdldkflwfiesnie
  

  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.