PDB entry 3ak2

View 3ak2 on RCSB PDB site
Description: Superoxide dismutase from Aeropyrum pernix K1, Mn-bound form
Class: oxidoreductase
Keywords: superoxide dismutase, cambialistic, OXIDOREDUCTASE
Deposited on 2010-06-30, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.188
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ak2a1, d3ak2a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ak2b1, d3ak2b2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ak2c1, d3ak2c2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn/Fe]
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ak2d1, d3ak2d2
  • Heterogens: MN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ak2A (A:)
    mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
    dvravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsa
    aaktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrg
    syvenwwnvvnwddvekrleqalnnakplyllpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak2A (A:)
    mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
    dvravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsa
    aaktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrg
    syvenwwnvvnwddvekrleqalnnakplyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ak2B (B:)
    mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
    dvravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsa
    aaktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrg
    syvenwwnvvnwddvekrleqalnnakplyllpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak2B (B:)
    kryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqidvra
    vmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsaaakt
    vegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrgsyve
    nwwnvvnwddvekrleqalnnakplyllp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ak2C (C:)
    mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
    dvravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsa
    aaktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrg
    syvenwwnvvnwddvekrleqalnnakplyllpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak2C (C:)
    mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
    dvravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsa
    aaktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrg
    syvenwwnvvnwddvekrleqalnnakply
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ak2D (D:)
    mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
    dvravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsa
    aaktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrg
    syvenwwnvvnwddvekrleqalnnakplyllpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ak2D (D:)
    vsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqid
    vravmrdfsfnyaghimhtifwpnmappgkgggtpggrvadliekqfggfekfkalfsaa
    aktvegvgwgvlafdplteelrilqvekhnvlmtaglvpilvidvwehayylqykndrgs
    yvenwwnvvnwddvekrleqalnnakply