PDB entry 3ajp

View 3ajp on RCSB PDB site
Description: Crystal structure of human H ferritin E140A mutant
Class: oxidoreductase
Keywords: 4-helix bundle, OXIDOREDUCTASE
Deposited on 2010-06-11, released 2010-08-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (139)
    Domains in SCOPe 2.04: d3ajpa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ajpA (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhkl
    atdkndphlcdfiethylnaqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ajpA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethylnaqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg