PDB entry 3aig

View 3aig on RCSB PDB site
Description: adamalysin II with peptidomimetic inhibitor pol656
Class: hydrolase/hydrolase inhibitor
Keywords: snake venom metalloendopetidase, zinc protease, metalloprotease, hydrolase-hydrolase inhibitor complex
Deposited on 1997-10-12, released 1998-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adamalysin II
    Species: Crotalus adamanteus [TaxId:8729]
    Database cross-references and differences (RAF-indexed):
    • GB AAB31038 (1-201)
    Domains in SCOPe 2.07: d3aiga_
  • Heterogens: ZN, CA, SO4, 0ZC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aigA (A:)
    enlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiws
    gqdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnpr
    ssvgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsd
    dsmgyyqkflnqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aigA (A:)
    nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
    qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
    svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
    smgyyqkflnqykpqcilnkp