PDB entry 3ai0

View 3ai0 on RCSB PDB site
Description: Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with para-nitrophenyl-beta-D-glucopyranoside
Class: hydrolase
Keywords: cellulases, glycosyl hydrolase, manganese enhancement, HYDROLASE
Deposited on 2010-05-06, released 2010-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.123
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Neotermes koshunensis [TaxId:60586]
    Gene: NkBG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T0W7 (Start-478)
      • engineered mutation (173)
    Domains in SCOPe 2.06: d3ai0a_
  • Heterogens: PNW, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ai0A (A:)
    mdvassdtvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdi
    addsyhlykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellang
    iepmvtmyhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfndpltfmd
    gyaseigmapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcep
    atnsaedrascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqfta
    eeveyirgthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvp
    wgfrkelnwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvi
    gytawslmdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrdl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ai0A (A:)
    tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
    ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
    yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfndpltfmdgyaseig
    mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
    rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
    gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
    nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
    mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd