PDB entry 3aht

View 3aht on RCSB PDB site
Description: Crystal structure of rice BGlu1 E176Q mutant in complex with laminaribiose
Class: hydrolase
Keywords: beta-alpha-barrels, glycoside hydrolase, oligosaccharide, hydrolase
Deposited on 2010-04-29, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase 7
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU1, BGLU7, LOC_Os03g49600, Os03g0703000, Os3BGlu7, OSJNBa0004L11.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75I93 (Start-480)
      • see remark 999 (28)
      • engineered mutation (180)
    Domains in SCOPe 2.06: d3ahta_
  • Chain 'B':
    Compound: Beta-glucosidase 7
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU1, BGLU7, LOC_Os03g49600, Os03g0703000, Os3BGlu7, OSJNBa0004L11.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75I93 (Start-480)
      • see remark 999 (28)
      • engineered mutation (180)
    Domains in SCOPe 2.06: d3ahtb_
  • Heterogens: LB2, ZN, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ahtA (A:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    qprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahtA (A:)
    wlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvatd
    qyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitpy
    vnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallgy
    dqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldfn
    wyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvkg
    sadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpwg
    mygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaidega
    nvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ahtB (B:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    qprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ahtB (B:)
    wlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvatd
    qyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitpy
    vnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallgy
    dqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldfn
    wyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvkg
    sadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpwg
    mygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaidega
    nvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh