PDB entry 3agv

View 3agv on RCSB PDB site
Description: Crystal structure of a human IgG-aptamer complex
Class: Immune System/RNA
Keywords: IgG, RNA Aptamer, Immune System-RNA complex
Deposited on 2010-04-08, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.237
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3agva1, d3agva2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3agvb1, d3agvb2
  • Chain 'S':
    Compound: 5'-r(*gp*gp*ap*gp*gp*(uft)p*gp*(cfz)p*(uft)p*(cfz)p*(cfz)p*gp*ap*ap*a*gp*gp*ap*ap*(cfz)p*(uft)p*(cfz)p*(cfz)p*a)-3'
  • Chain 'U':
    Compound: 5'-r(*gp*gp*ap*gp*gp*(uft)p*gp*(cfz)p*(uft)p*(cfz)p*(cfz)p*gp*ap*ap*a*gp*gp*ap*ap*(cfz)p*(uft)p*(cfz)p*(cfz)p*a)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3agvA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agvA (A:)
    flfppkpkdtlmisrtpevtcvevkfnwyvdgvevhnaktkpreeqyvvsvltvlhqdwl
    ngkeykcktiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngq
    pennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3agvB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3agvB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'S':
    No sequence available.

  • Chain 'U':
    No sequence available.