PDB entry 3ag3

View 3ag3 on RCSB PDB site
Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Copper, Electron transport, Formylation, Heme, Iron, Membrane, Mitochondrion, Mitochondrion inner membrane, Respiratory chain, Transmembrane, Transport, Acetylation, Transit peptide, Zinc, Isopeptide bond, Ubl conjugation
Deposited on 2010-03-19, released 2010-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3b1, d3ag3b2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3c_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3d_
  • Chain 'E':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3e_
  • Chain 'F':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3f_
  • Chain 'G':
    Compound: Cytochrome c oxidase subunit 6A2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3g_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3h_
  • Chain 'I':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3i_
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide 7A1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3j_
  • Chain 'K':
    Compound: Cytochrome c oxidase subunit 7B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3k_
  • Chain 'L':
    Compound: Cytochrome c oxidase subunit 7C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3l_
  • Chain 'M':
    Compound: Cytochrome c oxidase subunit 8B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3m_
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3n_
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3o1, d3ag3o2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3p_
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3q_
  • Chain 'R':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3r_
  • Chain 'S':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3s_
  • Chain 'T':
    Compound: Cytochrome c oxidase subunit 6A2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3t_
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3u_
  • Chain 'V':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3v_
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide 7A1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3w_
  • Chain 'X':
    Compound: Cytochrome c oxidase subunit 7B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3x_
  • Chain 'Y':
    Compound: Cytochrome c oxidase subunit 7C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3y_
  • Chain 'Z':
    Compound: Cytochrome c oxidase subunit 8B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ag3z_
  • Heterogens: HEA, NO, CU, MG, NA, TGL, PGV, CUA, PSC, CHD, UNX, PEK, CDL, ZN, DMU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3A (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3B (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ag3C (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3C (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ag3D (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3D (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ag3E (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3E (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3F (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ag3G (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3G (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ag3H (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3H (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3I (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ag3J (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3J (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ag3K (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3K (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ag3L (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3L (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3ag3M (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3M (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3N (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3O (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3ag3P (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3P (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3ag3Q (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3Q (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3ag3R (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3R (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3S (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3ag3T (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3T (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3ag3U (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3U (U:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ag3V (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3ag3W (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3W (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3ag3X (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3X (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3ag3Y (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3Y (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3ag3Z (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ag3Z (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks