PDB entry 3aey

View 3aey on RCSB PDB site
Description: Apo form of threonine synthase from Thermus thermophilus HB8
Class: lyase
Keywords: Threonine synthase, PLP, Pyridoxal phosphate, LYASE
Deposited on 2010-02-17, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3aeya_
  • Chain 'B':
    Compound: threonine synthase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3aeyb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aeyA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aeyA (A:)
    rpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfk
    drgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqsl
    vhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphy
    halpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatai
    rignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkll
    regrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aeyB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aeyB (B:)
    rpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfk
    drgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyalgkvaqslv
    hgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyh
    alpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatair
    ignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkllr
    egrlepestvvltltghglkdpataervaelpppvparleavaaaagl