PDB entry 3aeo

View 3aeo on RCSB PDB site
Description: Reaction intermediate structure of Entamoeba histolytica methionine gamma-lyase 1 containing methionine alpha, beta-enamine-pyridoxamine-5'-phosphate
Class: lyase
Keywords: gamma-lyase, L-methionine, entamoeba histolytica, lyase
Deposited on 2010-02-10, released 2011-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.155
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.06: d3aeoa_
  • Chain 'B':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.06: d3aeob_
  • Chain 'C':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.06: d3aeoc_
  • Chain 'D':
    Compound: methionine gamma-lyase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: metG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86D28
      • see remark 999 (307)
    Domains in SCOPe 2.06: d3aeod_
  • Heterogens: 3LM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aeoA (A:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aeoA (A:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aeoB (B:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aeoB (B:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3aeoC (C:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aeoC (C:)
    aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
    qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
    gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
    ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
    mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
    ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
    pelvrisvgienvddiiadlkqalelw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3aeoD (D:)
    mtaqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnpt
    veqfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlp
    rfgievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvd
    atftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslm
    apmdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqm
    tgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqg
    itpelvrisvgienvddiiadlkqalelw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aeoD (D:)
    ditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptveqf
    eemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprfgi
    evdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdatft
    spcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmapmd
    aflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtgyg
    stflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgitpe
    lvrisvgienvddiiadlkqalel