PDB entry 3adu

View 3adu on RCSB PDB site
Description: Human PPARgamma ligand-binding domain in complex with 5-methoxy-indole acetate
Class: transcription
Keywords: nuclear receptor, ligand-dependent transcription factor, ligand-binding domain, Activator, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2010-01-29, released 2010-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARgamma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3adua_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARgamma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3adub_
  • Heterogens: MYI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aduA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aduA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aduB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aduB (B:)
    esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkikfkhitpl
    qeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytml
    aslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiav
    iilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehv
    qllqvikktetslhpllqeiy