PDB entry 3abl

View 3abl on RCSB PDB site
Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
Class: oxidoreductase
Keywords: Oxidoreductase, Copper, Electron transport, Formylation, Heme, Iron, Membrane, Mitochondrion, Mitochondrion inner membrane, Respiratory chain, Transmembrane, Transport, Acetylation, Transit peptide, Zinc, Isopeptide bond, Ubl conjugation
Deposited on 2009-12-16, released 2010-01-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3abla_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablb1, d3ablb2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablc_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3abld_
  • Chain 'E':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3able_
  • Chain 'F':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablf_
  • Chain 'G':
    Compound: Cytochrome c oxidase subunit 6A2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablg_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablh_
  • Chain 'I':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3abli_
  • Chain 'J':
    Compound: Cytochrome c oxidase polypeptide 7A1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablj_
  • Chain 'K':
    Compound: Cytochrome c oxidase subunit 7B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablk_
  • Chain 'L':
    Compound: Cytochrome c oxidase subunit 7C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3abll_
  • Chain 'M':
    Compound: Cytochrome c oxidase subunit 8B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablm_
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3abln_
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablo1, d3ablo2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablp_
  • Chain 'Q':
    Compound: Cytochrome c oxidase subunit 4 isoform 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablq_
  • Chain 'R':
    Compound: Cytochrome c oxidase subunit 5A
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablr_
  • Chain 'S':
    Compound: Cytochrome c oxidase subunit 5B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3abls_
  • Chain 'T':
    Compound: Cytochrome c oxidase subunit 6A2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablt_
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablu_
  • Chain 'V':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablv_
  • Chain 'W':
    Compound: Cytochrome c oxidase polypeptide 7A1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablw_
  • Chain 'X':
    Compound: Cytochrome c oxidase subunit 7B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablx_
  • Chain 'Y':
    Compound: Cytochrome c oxidase subunit 7C
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ably_
  • Chain 'Z':
    Compound: Cytochrome c oxidase subunit 8B
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ablz_
  • Heterogens: CU, PER, MG, NA, HEA, TGL, PGV, CUA, PSC, CHD, DMU, UNX, CDL, ZN, PEK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ablA (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ablB (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ablC (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablC (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ablD (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablD (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ablE (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablE (E:)
    etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
    rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ablF (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablF (F:)
    ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
    ednstviwfwlhkgeaqrcpscgthyklvphql
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ablG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablG (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ablH (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablH (H:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ablI (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablI (I:)
    alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
    mrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ablJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablJ (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ablK (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablK (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ablL (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablL (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3ablM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablM (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ablN (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ablO (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3ablP (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablP (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3ablQ (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablQ (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3ablR (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablR (R:)
    etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
    rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3ablS (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablS (S:)
    ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
    ednstviwfwlhkgeaqrcpscgthyklvphql
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3ablT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablT (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3ablU (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablU (U:)
    yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
    twddrraegtfpgki
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3ablV (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablV (V:)
    alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
    mrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3ablW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablW (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3ablX (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablX (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3ablY (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablY (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3ablZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ablZ (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks