PDB entry 3aaz

View 3aaz on RCSB PDB site
Description: Crystal structure of the humanized recombinant Fab fragment of a murine; antibody
Class: immune system
Keywords: antibody engineering, humanization, hWO-2 Fab, IMMUNE SYSTEM
Deposited on 2009-11-28, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Humanized recombinant Fab fragment of a murine; antibody
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV2-5*08
    Database cross-references and differences (RAF-indexed):
    • PDB 3AAZ (0-End)
  • Chain 'B':
    Compound: Humanized recombinant Fab fragment of a murine; antibody
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHJ4*01
    Database cross-references and differences (RAF-indexed):
    • PDB 3AAZ (0-228)
    Domains in SCOPe 2.07: d3aazb1, d3aazb2
  • Chain 'H':
    Compound: Humanized recombinant Fab fragment of a murine; antibody
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV2-5*08
    Database cross-references and differences (RAF-indexed):
    • PDB 3AAZ (0-228)
  • Chain 'L':
    Compound: Humanized recombinant Fab fragment of a murine; antibody
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHJ4*01
    Database cross-references and differences (RAF-indexed):
    • PDB 3AAZ (0-End)
    Domains in SCOPe 2.07: d3aazl1, d3aazl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aazB (B:)
    divmtqsplslpvtpgepasiscrssqsivhsnghtylewylqkpgqsprlliyqvstrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqaslvpltfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgecaaadykdddd
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3aazL (L:)
    divmtqsplslpvtpgepasiscrssqsivhsnghtylewylqkpgqsprlliyqvstrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqaslvpltfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgecaaadykdddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aazL (L:)
    divmtqsplslpvtpgepasiscrssqsivhsnghtylewylqkpgqsprlliyqvstrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqaslvpltfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgecaaadykddd