PDB entry 3aak

View 3aak on RCSB PDB site
Description: Crystal structure of Zn2+-bound form of des3-20ALG-2F122A
Class: apoptosis
Keywords: PENTA-EF-HAND PROTEIN, CALCIUM-BINDING PROTEIN, Apoptosis, Endoplasmic reticulum
Deposited on 2009-11-19, released 2010-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.254
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75340 (Start-171)
      • engineered mutation (102)
    Domains in SCOPe 2.06: d3aaka_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3aakA (A:)
    aalpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkag
    vnfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgagyrlsdqfhdilirkfd
    rqgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aakA (A:)
    qsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfse
    ftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgagyrlsdqfhdilirkfdrqgrg
    qiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv