PDB entry 3aaj

View 3aaj on RCSB PDB site
Description: Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122
Class: apoptosis
Keywords: PENTA-EF-HAND PROTEIN, CALCIUM-BINDING PROTEIN, Apoptosis, Endoplasmic reticulum
Deposited on 2009-11-19, released 2010-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aaja_
  • Chain 'B':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3aajb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3aajA (A:)
    adqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnf
    seftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgyrlsdqfhdilirkfdrqgrg
    qiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3aajB (B:)
    adqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnf
    seftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgyrlsdqfhdilirkfdrqgrg
    qiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3aajB (B:)
    lwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfseftg
    vwkyitdwqnvfrtydrdnsgmidknelkqalsgyrlsdqfhdilirkfdrqgrgqiafd
    dfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv