PDB entry 3a7e

View 3a7e on RCSB PDB site
Description: Crystal structure of human COMT complexed with SAM and 3,5-dinitrocatechol
Class: transferase
Keywords: COMT, ALTERNATIVE INITIATION, CATECHOLAMINE METABOLISM, MAGNESIUM, METHYLTRANSFERASE, NEUROTRANSMITTER DEGRADATION, S-ADENOSYL-L-METHIONINE, TRANSFERASE, Cell membrane, Membrane, Metal-binding, Phosphoprotein, Signal-anchor, Transmembrane
Deposited on 2009-09-26, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a7ea_
  • Heterogens: MG, SAM, DNC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a7eA (A:)
    gsmgdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehq
    psvllelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvga
    sqdiipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapd
    flahvrgsscfecthyqsfleyrevvdglekaiykg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a7eA (A:)
    dtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsvl
    lelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqdi
    ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdflah
    vrgsscfecthyqsfleyrevvdglekaiykg