PDB entry 3a6b
View 3a6b on RCSB PDB site
Description: Crystal Structure of HyHEL-10 Fv mutant LN32D complexed with hen egg white lysozyme
Class: immune system/hydrolase
Keywords: ANTIGEN-ANTIBODY COMPLEX, MUTANT, IMMUNE SYSTEM-HYDROLASE COMPLEX, Allergen, Antimicrobial, Bacteriolytic enzyme, Disulfide bond, Glycosidase
Deposited on
2009-08-28, released
2009-12-22
The last revision prior to the SCOPe 2.01 freeze date was dated
2010-05-19, with a file datestamp of
2010-05-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: IG VH, anti-lysozyme
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3a6bh_ - Chain 'L':
Compound: lysozyme binding Ig kappa chain V23-J2 region
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3a6bl_ - Chain 'Y':
Compound: Lysozyme C
Species: Gallus gallus [TaxId:9031]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>3a6bH (H:)
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>3a6bL (L:)
divltqspatlsvtpgnsvslscrasqsigndlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
- Chain 'Y':
No sequence available.