PDB entry 3a58

View 3a58 on RCSB PDB site
Description: Crystal structure of Sec3p - Rho1p complex from Saccharomyces cerevisiae
Class: protein transport/exocytosis
Keywords: protein complex, PH domain, GTPase, membrane traffic, Exocytosis, Phosphoprotein, Protein transport, Transport, Cell membrane, Endosome, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Peroxisome, Prenylation, PROTEIN TRANSPORT-EXOCYTOSIS COMPLEX
Deposited on 2009-08-03, released 2010-01-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exocyst complex component SEC3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC3, PSL1, YER008C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GTP-binding protein RHO1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RHO1, YPR165W, P9325.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06780
      • engineered (29)
    Domains in SCOPe 2.05: d3a58b_
  • Chain 'C':
    Compound: Exocyst complex component SEC3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC3, PSL1, YER008C
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: GTP-binding protein RHO1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RHO1, YPR165W, P9325.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06780
      • engineered (29)
    Domains in SCOPe 2.05: d3a58d_
  • Chain 'E':
    Compound: Exocyst complex component SEC3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC3, PSL1, YER008C
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: GTP-binding protein RHO1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RHO1, YPR165W, P9325.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06780
      • engineered (29)
    Domains in SCOPe 2.05: d3a58f_
  • Heterogens: PO4, GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a58B (B:)
    msqqvgnsirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvel
    alwdtagqedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilv
    gckvdlrndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaat
    raslmgks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a58B (B:)
    sirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvelalwdtag
    qedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilvgckvdlr
    ndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaatraslm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3a58D (D:)
    msqqvgnsirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvel
    alwdtagqedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilv
    gckvdlrndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaat
    raslmgks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a58D (D:)
    sirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvelalwdtag
    qedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilvgckvdlr
    ndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaatraslm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a58F (F:)
    msqqvgnsirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvel
    alwdtagqedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilv
    gckvdlrndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaat
    raslmgks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a58F (F:)
    nsirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvelalwdta
    gqedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilvgckvdl
    rndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaatraslmg
    k