PDB entry 3a4r

View 3a4r on RCSB PDB site
Description: The crystal structure of SUMO-like domain 2 in Nip45
Class: transcription
Keywords: ubiquitin fold, Coiled coil, Cytoplasm, Methylation, Nucleus, TRANSCRIPTION
Deposited on 2009-07-14, released 2010-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.159
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NFATC2-interacting protein
    Species: Mus musculus [TaxId:10090]
    Gene: Nip45
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09130 (5-78)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d3a4ra1, d3a4ra2
  • Chain 'B':
    Compound: NFATC2-interacting protein
    Species: Mus musculus [TaxId:10090]
    Gene: Nip45
    Database cross-references and differences (RAF-indexed):
    • Uniprot O09130 (Start-78)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3a4rb1, d3a4rb2
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a4rA (A:)
    gplgsqelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsg
    kelpadlglesgdlievwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a4rB (B:)
    gplgsqelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsg
    kelpadlglesgdlievwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a4rB (B:)
    gpllrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsgkelp
    adlglesgdlievwg