PDB entry 3a40

View 3a40 on RCSB PDB site
Description: Crystal structure of the human VDR ligand binding domain bound to the synthetic agonist compound 2alpha-methyl-AMCR277B(C23R)
Class: gene regulation
Keywords: Transcription, Structural Genomics, SPINE2, Structural Proteomics in Europe 2, GENE REGULATION
Deposited on 2009-06-25, released 2010-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3a40x_
  • Heterogens: 23R, SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3a40X (X:)
    gshmdslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsql
    smlphladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddm
    swtcgnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrp
    gvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrcl
    sfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a40X (X:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
    hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
    gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
    aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
    ecsmkltplvlevfg