PDB entry 3a3w

View 3a3w on RCSB PDB site
Description: Structure of OpdA mutant (G60A/A80V/S92A/R118Q/K185R/Q206P/D208G/I260T/G273S) with diethyl 4-methoxyphenyl phosphate bound in the active site
Class: Hydrolase
Keywords: phosphotriesterase, OPDA, metalloenzyme, hydrolase
Deposited on 2009-06-23, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-328)
      • engineered (27)
      • engineered (47)
      • engineered (59)
      • engineered (85)
      • engineered (152)
      • engineered (173)
      • engineered (175)
      • engineered (227)
      • engineered (240)
    Domains in SCOPe 2.08: d3a3wa_
  • Heterogens: CO, EPL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3a3wA (A:)
    tgdlintvrgpipvseagftlthehicassagflrawpeffgsrkalvekavrglrhara
    agvqtivdvstfdigrdvrllaevsqaadvhivaatglwfdpplsmrmrsveeltqfflr
    eiqhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsasprggeqq
    aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysatglegnasalalf
    strswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt