PDB entry 3a3q

View 3a3q on RCSB PDB site
Description: Structure of N59D HEN EGG-WHITE LYSOZYME in complex with (GlcNAc)3
Class: Hydrolase
Keywords: Alpha and beta, Allergen, Antimicrobial, Bacteriolytic enzyme, Disulfide bond, Glycosidase, Hydrolase
Deposited on 2009-06-16, released 2009-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • engineered (58)
  Domains in SCOPe 2.07: d3a3qa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3a3qA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqids
  rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
  qawirgcrl