PDB entry 3a2n

View 3a2n on RCSB PDB site
Description: Crystal structure of DBJA (Wild Type Type II P21)
Class: hydrolase
Keywords: A/B-HYDROLASE, Hydrolase
Deposited on 2009-05-23, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2na_
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2nb_
  • Chain 'E':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2ne_
  • Chain 'F':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3a2nf_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2nA (A:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2nA (A:)
    rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
    gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
    rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
    gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
    epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a2nB (B:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2nB (B:)
    rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
    gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
    rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
    gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
    epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3a2nE (E:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2nE (E:)
    rrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgqs
    gkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmefi
    rpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrkl
    gdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftg
    epgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3a2nF (F:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafverv
    lpggivrklgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaas
    sypkllftgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiag
    ieavrpqlaavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2nF (F:)
    irrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligfgq
    sgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafmef
    irpmptwqdfhhtevaeeqdhaeaaravfrkfrtpgegeamileanafvervlpggivrk
    lgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllft
    gepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq