PDB entry 3a2l

View 3a2l on RCSB PDB site
Description: Crystal structure of DBJA (mutant dbja delta)
Class: hydrolase
Keywords: A/B-HYDROLASE, Hydrolase
Deposited on 2009-05-23, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.171
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3a2la_
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Bradyrhizobium japonicum [TaxId:375]
    Gene: DBJA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3a2lb_
  • Heterogens: CL, SUC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2lA (A:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhqdhaeaaravfrkfrtpgegeamileanafvervlpggivr
    klgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllf
    tgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq
    laahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2lA (A:)
    ieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdligf
    gqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglafm
    efirpmptwqdfhqdhaeaaravfrkfrtpgegeamileanafvervlpggivrklgdee
    mapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftgepga
    lvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a2lB (B:)
    mskpieieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahcia
    pdligfgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfv
    rglafmefirpmptwqdfhqdhaeaaravfrkfrtpgegeamileanafvervlpggivr
    klgdeemapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllf
    tgepgalvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavrpq
    laahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2lB (B:)
    eieirrapvlgssmayretgaqdapvvlflhgnptsshiwrnilplvspvahciapdlig
    fgqsgkpdiayrffdhvryldafieqrgvtsaylvaqdwgtalafhlaarrpdfvrglaf
    mefirpmptwqdfhqdhaeaaravfrkfrtpgegeamileanafvervlpggivrklgde
    emapyrtpfptpesrrpvlafprelpiagepadvyealqsahaalaassypkllftgepg
    alvspefaerfaasltrcalirlgaglhylqedhadaigrsvagwiagieavr