PDB entry 3a2f

View 3a2f on RCSB PDB site
Description: Crystal Structure of Pyrococcus furiosus DNA polymerase/PCNA monomer mutant complex
Class: transferase/replication
Keywords: DNA replication, DNA-binding, DNA-directed DNA polymerase, Endonuclease, Hydrolase, Nuclease, Nucleotidyltransferase, Transferase, TRANSFERASE/REPLICATION COMPLEX
Deposited on 2009-05-15, released 2009-11-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pol, PF0212
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3a2fa1, d3a2fa2
  • Chain 'B':
    Compound: DNA polymerase sliding clamp
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pcn, PF0983
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73947 (0-End)
      • engineered (71)
      • engineered (141)
      • engineered (145)
    Domains in SCOPe 2.03: d3a2fb1, d3a2fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a2fA (A:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdvptirekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadeneakvitwknidlpy
    vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwenivyldfralypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkeviqklanyeippek
    laiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrgdgpisnrailaee
    ydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvgltswlnikks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2fA (A:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdvptirekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadeneakvitwknidlpy
    vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwenivyldfralypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkeviqklanyeippek
    laiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrgdgpisnrailaee
    ydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvgltswlnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3a2fB (B:)
    pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
    evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplidveem
    evdlpelpftakvvvlgevlkaavkaaslvsdsikfiarenefimkaegetqeveikltl
    edeglldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltf
    llaprvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a2fB (B:)
    pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
    evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplidveem
    evdlpelpftakvvvlgevlkaavkaaslvsdsikfiarenefimkaegetqeveikltl
    edeglldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltf
    llaprve