PDB entry 3a1w

View 3a1w on RCSB PDB site
Description: Crystal structue of the G domain of T. maritima FeoB iron iransporter
Class: transport protein
Keywords: FeoB, iron transporter, small GTPase, GDI, G protein, TRANSPORT PROTEIN
Deposited on 2009-04-22, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron(II) transport protein B
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0051
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXQ8 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d3a1wa1, d3a1wa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3a1wA (A:)
    gplhmvkvalagcpnvgktslfnaltgtkqyvanwpgvtvekkegvftykgytinlidlp
    gtyslgyssidekiardyllkgdadlvilvadsvnpeqslyllleilemekkvilamtai
    deakktgmkidryelqkhlgipvvftssvtgegleelkekiveyaqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3a1wA (A:)
    hmvkvalagcpnvgktslfnaltgtkqyvanwpgvtvekkegvftykgytinlidlpgty
    slgyssidekiardyllkgdadlvilvadsvnpeqslyllleilemekkvilamtaidea
    kkidryelqkhlgipvvftssvtgegleelkekiveyaq